PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490744.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 836aa    MW: 93579.1 Da    PI: 10.017
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490744.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.44.7e-1227116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++++rl++p +fa+ + ++  +   + le +sg++Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v+
  XP_016490744.1  27 FFKII--LSQHERSRLRIPEDFASIYCKNMLN--PVYLEVPSGEVWEVEV--VHSQGQICLGIGWQDFSDFYSISRGHFLMFGYNARSHF--NVS 113
                     67777..78889999********877444334..4***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016490744.1 114 IFD 116
                     997 PP

2B350.92.8e-16282374498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  kfa+++ +++ ++  l++  +   sW+vk+  + ++      +GWk Fv +n+Lk gD++vF++++ ++    v++fr
  XP_016490744.1 282 FMQPSYVFSPFSLSIALKFARKYFLENYGNLVLRVPGRGRGSWSVKC--TTRGTNAKVHSGWKAFVLDNKLKCGDVCVFEVIKGTRLFIDVTIFR 374
                     5789*******************88888887888888888*******..66666677899********************987655556677766 PP

3B336.86.7e-12537629598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                     + ps+v+k   l ++  fa ++  ++ ++  l++  + + sW vk+   k++ ++ ++  Wk Fv +n+Lk gD +vF+l++  ++  l v++fr
  XP_016490744.1 537 MQPSYVSKPYSLHISLLFAVKYFRENCGNLVLRVPGSGSGSWPVKYALGKSKPKICFS--WKAFVLDNKLKFGDACVFELIKGgTKPILDVTIFR 629
                     67899999999***********65544544555555666*******988888888888..********************976566667777776 PP

4B3543.1e-17736826395
                     EE-..-HHHHT....T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   3 kvltpsdvlks....grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     + ++++++ +s     +l++  + a+++   k++  +++l+++s rsW vk+  + +     lt+GWkeFv +n+Lk+gD++vF++++rs+   +
  XP_016490744.1 736 TCFMQPSYVSSasgpMQLSITLSRARKFFAAKHS--DVVLQNSSKRSWAVKC--SLGTVNAKLTSGWKEFVLDNNLKVGDVCVFERVSRSKL--L 824
                     5555444444446668899999999999755444..8***************..55555677***********************7766555..4 PP

                     EE CS
              B3  94 vk 95 
                     + 
  XP_016490744.1 825 FN 826
                     44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.2E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-1721118IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.27925118IPR003340B3 DNA binding domain
CDDcd100171.30E-1025116No hitNo description
PfamPF023621.5E-827116IPR003340B3 DNA binding domain
SMARTSM010195.2E-928118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-21271376IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-19272375IPR015300DNA-binding pseudobarrel domain
CDDcd100172.89E-17277374No hitNo description
SMARTSM010195.2E-12278376IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561279376IPR003340B3 DNA binding domain
PfamPF023623.1E-13282374IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-16525630IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-16526629IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-11532631IPR003340B3 DNA binding domain
PROSITE profilePS5086310.644533631IPR003340B3 DNA binding domain
CDDcd100171.02E-14537629No hitNo description
PfamPF023621.8E-9537629IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.5E-23727830IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.58E-20730831IPR015300DNA-binding pseudobarrel domain
CDDcd100172.52E-15733830No hitNo description
PROSITE profilePS5086313.084738833IPR003340B3 DNA binding domain
SMARTSM010197.4E-10738828IPR003340B3 DNA binding domain
PfamPF023625.1E-15745825IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MAAKPHLQSG ESSSNWKSST NITQPKFFKI ILSQHERSRL RIPEDFASIY CKNMLNPVYL  60
EVPSGEVWEV EVVHSQGQIC LGIGWQDFSD FYSISRGHFL MFGYNARSHF NVSIFDLSAS  120
EIEYPYSSAH GIHTPIFHCH ETRHAPKRDQ SESDDSVEIL EGIPRSQKAK AIIPDTIEHS  180
VENLGHCPLG QSSKRKRKEG DTENDVSVDM HIKRMEVEKS QENVASPSFT REGKKSNKGC  240
RMQKQQSESV YGPNKAVMDR KSAVAYQRAK AFKSKNPFMT SFMQPSYVFS PFSLSIALKF  300
ARKYFLENYG NLVLRVPGRG RGSWSVKCTT RGTNAKVHSG WKAFVLDNKL KCGDVCVFEV  360
IKGTRLFIDV TIFRAAGSTL MHKIIGEVPG DSDSKSNVFK TDNCVPCSQP KVVHTKKLKQ  420
RKGEEHGEGT EIEHSVEILG HCPLAHGSKR KRPEGEAEGN VSIDIHTKSI NVENTQEHVA  480
SPSITRKTKR SGESCRMHKQ QSEVVYAKNK TVDKERSIAY QRAKAFTSEN PFVIYFMQPS  540
YVSKPYSLHI SLLFAVKYFR ENCGNLVLRV PGSGSGSWPV KYALGKSKPK ICFSWKAFVL  600
DNKLKFGDAC VFELIKGGTK PILDVTIFRA AESKPMHKID AKLAGVSDSK KKTIKTENSV  660
PCSQPKIVHS RKLNFEKKQR GDSDCFTSKI KEEPSEAAGK HVQQSKSSCK GSAVAKEMVL  720
AYLRAKAFTS ENPFFTCFMQ PSYVSSASGP MQLSITLSRA RKFFAAKHSD VVLQNSSKRS  780
WAVKCSLGTV NAKLTSGWKE FVLDNNLKVG DVCVFERVSR SKLLFNVIIY TSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1424837418141B3 domain-containing transcription factor VRN
4i1k_B4e-1424837418141B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-44HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-44HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490744.10.0PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X2
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-35B3 family protein